prepaid kosten nachvollziehen vodafone

], "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditAction", "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", { ], "context" : "", }, ] }, "actions" : [ }); "}); }, { "action" : "rerender" }, Vodafone bietet grundsätzlich die gleichen Möglichkeiten eine Prepaid Karte zu kaufen, wie das auch andere Anbieter tun, nämlich. }, count = 0; window.location.replace('/t5/user/userloginpage'); ] count++; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); } } Wer nur Guthaben kaufen will und keine SIM-Karte, der hat noch weitaus mehr Möglichkeiten, nämlich. ], }, "kudosLinksDisabled" : "false", "event" : "MessagesWidgetEditAnswerForm", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", } "action" : "pulsate" if ( count == neededkeys.length ) { Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "removeThreadUserEmailSubscription", { "event" : "removeThreadUserEmailSubscription", ] }, ] { "event" : "MessagesWidgetAnswerForm", "actions" : [ "actions" : [ "context" : "", LITHIUM.Dialog.options['-1644067994'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "initiatorDataMatcher" : "data-lia-message-uid" "event" : "RevokeSolutionAction", { "context" : "", } } } LITHIUM.Loader.runJsAttached(); "action" : "rerender" "eventActions" : [ ], "action" : "rerender" "action" : "rerender" "}); "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); } { }); } })(LITHIUM.jQuery); { }, { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:quiltName,message", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1914099 .lia-rating-control-passive', '#form_2'); }, if ( neededkeys[count] == key ) { { ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "kudosLinksDisabled" : "false", { "disallowZeroCount" : "false", "actions" : [ }); "actions" : [ ] "event" : "ProductMessageEdit", }, { "initiatorBinding" : true, // console.log('watching: ' + key); "displaySubject" : "true", { "event" : "markAsSpamWithoutRedirect", "selector" : "#kudosButtonV2_2", "initiatorBinding" : true, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1914245 .lia-rating-control-passive', '#form_6'); "initiatorDataMatcher" : "data-lia-message-uid" $(this).removeAttr('href'); "actions" : [ "context" : "", "event" : "QuickReply", ] { } "event" : "ProductAnswer", "action" : "rerender" "actions" : [ Bist du sicher, dass du fortfahren möchtest? "event" : "MessagesWidgetEditAnswerForm", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { }, ] ] "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "", "useSimpleView" : "false", } } "actions" : [ "event" : "removeMessageUserEmailSubscription", "useSubjectIcons" : "true", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/58546","ajaxErrorEventName":"LITHIUM:ajaxError","token":"evPUc5hlt3Q6S8SkboJGUYgqGgRbnRf7tVO8XiMCdeQ. "event" : "MessagesWidgetMessageEdit", } }, LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", }, }); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1914179 .lia-rating-control-passive', '#form_4'); if ( neededkeys[count] == key ) { { }, "actions" : [ ] { "linkDisabled" : "false" { "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", } { Gern sende ich Dir eine Übersicht an Deine hinterlegte Adresse. "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); ], ] ] "action" : "rerender" "context" : "envParam:quiltName", "actions" : [ "disallowZeroCount" : "false", "actions" : [ "context" : "", "parameters" : { "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "kudosable" : "true", }, "event" : "ProductAnswerComment", "disableKudosForAnonUser" : "false", "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", "disableKudosForAnonUser" : "false", { "context" : "envParam:entity", } LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { } "eventActions" : [ "componentId" : "forums.widget.message-view", "context" : "", "event" : "RevokeSolutionAction", "actions" : [ } }, "parameters" : { LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ ] { } } { "actions" : [ "event" : "MessagesWidgetCommentForm", ] "action" : "rerender" }, { }, "parameters" : { { $(this).next().toggle(); } }); { Execute whatever should happen when entering the right sequence { "linkDisabled" : "false" "useSimpleView" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "lia-deleted-state", "context" : "envParam:quiltName,message", "initiatorDataMatcher" : "data-lia-message-uid" }); "action" : "rerender" "action" : "pulsate" }); "event" : "markAsSpamWithoutRedirect", "initiatorBinding" : true, "action" : "rerender" "actions" : [ "actions" : [ "context" : "envParam:quiltName", ] } "event" : "MessagesWidgetEditAction", "initiatorBinding" : true, "actions" : [ }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1914245,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "truncateBodyRetainsHtml" : "false", "action" : "rerender" "action" : "pulsate" LITHIUM.AjaxSupport.ComponentEvents.set({ { "actions" : [ ] "showCountOnly" : "false", "event" : "deleteMessage", "context" : "envParam:entity", "initiatorDataMatcher" : "data-lia-kudos-id" ] "action" : "rerender" "action" : "rerender" "context" : "lia-deleted-state", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_6f0bff9ad14ff6', 'disableAutoComplete', '#ajaxfeedback_6f0bff9796685d_0', 'LITHIUM:ajaxError', {}, 'dX3wag7topxLPuK23Q3SxqtwcUM9VuOIHBkDtT5CnII. ] LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "AcceptSolutionAction", "event" : "QuickReply", { ] }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "event" : "MessagesWidgetEditAction", "actions" : [ "context" : "", { "parameters" : { }, }, "actions" : [ }, }, ;(function($) { "action" : "rerender" }, "initiatorDataMatcher" : "data-lia-message-uid" "linkDisabled" : "false" { }, }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/58546","ajaxErrorEventName":"LITHIUM:ajaxError","token":"s71FaYoIjymfc29F3N58M9uwpHP6EUfZK61ZjHKzRk8. Eine Liste der Städte findest Du auf unserer Seite zur Netzabdeckung. ] "action" : "rerender" { $(document).ready(function(){ ;(function($) { "eventActions" : [ ] "actions" : [ "useCountToKudo" : "false", "event" : "RevokeSolutionAction", "event" : "MessagesWidgetCommentForm", "parameters" : { }, { ich sehe mir gern an was bei Deiner Rufnummer los ist. Hier kannst Du sehen, welche Rufnummern zu welchem Zeitpunkt angerufen wurden, wie lange das Gespräch gedauert hat, in welches Netz telefoniert wurde und welche Kosten dafür angefallen sind. } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); // enable redirect to login page when "logmein" is typed into the void =) "action" : "rerender" "context" : "envParam:feedbackData", "event" : "AcceptSolutionAction", { ] } }, } }, "actions" : [ { "action" : "addClassName" "selector" : "#messageview_3", })(LITHIUM.jQuery); // Pull in global jQuery reference LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "context" : "", "revokeMode" : "true", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", "displayStyle" : "horizontal", "useSimpleView" : "false", "actions" : [ "}); "event" : "unapproveMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/58546","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-ykn3qoxcUKosePbkvvNmxkvE-a12J-mCNvPpbcWih4. ] "initiatorBinding" : true, "action" : "rerender" { "event" : "MessagesWidgetMessageEdit", "revokeMode" : "true", "actions" : [ "actions" : [ "context" : "", ] { { "entity" : "1914266", "event" : "expandMessage", "context" : "", }; ] LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); $(this).next().toggle(); "event" : "ProductMessageEdit", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "addMessageUserEmailSubscription", { "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "ProductAnswer", "action" : "rerender" { "displayStyle" : "horizontal", if ( key == neededkeys[0] ) { }, "action" : "pulsate" "event" : "unapproveMessage", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1914203,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ { "actions" : [ "useSubjectIcons" : "true", } }, var count = 0; { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/58546","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Z1BX4D2imXSEVqFPN8JccJtK_RD5C5xdxdi_WC1C0WE. } { "actions" : [ "context" : "envParam:entity", { "action" : "rerender" "action" : "rerender" if ( key == neededkeys[0] ) { { "context" : "", { } "actions" : [ "context" : "", "event" : "removeMessageUserEmailSubscription", "event" : "deleteMessage", }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ], "truncateBodyRetainsHtml" : "false", "actions" : [ "event" : "QuickReply", { "event" : "ProductAnswer", "kudosable" : "true", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" "actions" : [ ] { } }, "event" : "ProductAnswerComment", }, LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); Gib Deine Daten ein und setz einen Haken vor Ich möchte meine Rufnummer mitnehmen. { { "actions" : [ ] "action" : "rerender" "action" : "rerender" "eventActions" : [ }, "useCountToKudo" : "false", { ] https://forum.vodafone.de/t5/Mobilfunk/Ungewollte-Kosten-durch-Drittanbieter-vermeiden-Oder-hilf-dir... ja, es waren "Einzelkäufe" (hatte ich ja oben auch kurz geschrieben). ], ] "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; LITHIUM.AjaxSupport.ComponentEvents.set({ "truncateBody" : "true", "action" : "rerender" } { ] "event" : "MessagesWidgetMessageEdit", { "context" : "", "revokeMode" : "true", "event" : "MessagesWidgetAnswerForm", ] ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); } "event" : "ProductMessageEdit", "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "context" : "lia-deleted-state", "actions" : [ { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1913985}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914033}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914089}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914099}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914143}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914179}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914203}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914245}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914266}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914379}}]); ] }, LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/58546","ajaxErrorEventName":"LITHIUM:ajaxError","token":"M_fY5U4RaUKyZfL1QbVJTp5PJVm7BUnd4vM4fkLCn4A. lithstudio: [], "context" : "", { "initiatorDataMatcher" : "data-lia-message-uid" "dialogContentCssClass" : "lia-panel-dialog-content", } "action" : "rerender" MwSt. } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "useSimpleView" : "false", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); "actions" : [ $(this).addClass('active') "context" : "lia-deleted-state", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'phs3Folq70CrgA6eN_mvWk2rdpvi7UvpTnbvJ9OMwVI. { "quiltName" : "ForumMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ ] "action" : "rerender" { }, "actions" : [ { }, { event.preventDefault(); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "", ] "event" : "editProductMessage", watching = true; LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1914245 .lia-rating-control-passive', '#form_6'); "componentId" : "forums.widget.message-view", ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); if ( count == neededkeys.length ) { "context" : "envParam:quiltName", { "context" : "envParam:selectedMessage", ;(function($) { Identifizier Dich am besten online per Video-Chat oder per eID. { { "action" : "rerender" { "action" : "rerender" }, "event" : "kudoEntity", { "event" : "kudoEntity", } "parameters" : { "initiatorBinding" : true, }, "forceSearchRequestParameterForBlurbBuilder" : "false", } } { { "action" : "rerender" { }, "disableKudosForAnonUser" : "false", "selector" : "#messageview_0", { ] "action" : "rerender" "event" : "addThreadUserEmailSubscription", { "kudosable" : "true", "}); } { "context" : "envParam:quiltName,expandedQuiltName", "event" : "MessagesWidgetAnswerForm", { "action" : "rerender" { { }, { { Je nach Auswahl siehst Du jetzt noch einige Fragen. { } } "context" : "", }, { "actions" : [ { "action" : "pulsate" "action" : "rerender" count = 0; "action" : "rerender" }, "action" : "rerender" LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); LITHIUM.Dialog({ "action" : "rerender" "context" : "", }, "eventActions" : [ LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_6f0bff9796685d', 'enableAutoComplete', '#ajaxfeedback_6f0bff9796685d_0', 'LITHIUM:ajaxError', {}, 'oMMRj97Pz7P9qJmXx3GUHfn-fGNkOZuuboyhD4AQl1A. }, { "context" : "envParam:quiltName", $(document).ready(function(){ "disallowZeroCount" : "false", ] Du bekommst dann eine SMS.Du hast Deine Prepaid-Karte im Supermarkt, an der Tankstelle oder im Fachhandel gekauft? "event" : "ProductAnswerComment", LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); }, "includeRepliesModerationState" : "false", }); } else { "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ LITHIUM.Dialog.options['325902959'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } ] "action" : "rerender" "selector" : "#messageview_2", } Gilt nicht fürs übrige Ausland, Rufumleitungen, Video-/Konferenzgespräche, Anrufe/ SMS zu Sondernummern, Premium-/Auskunfts-/Massenverkehrs-/Service- und Kurzwahldienste. "componentId" : "forums.widget.message-view", "selector" : "#messageview_2", "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "actions" : [ }, } "action" : "rerender" { "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, "action" : "rerender" "event" : "unapproveMessage", { "context" : "", "event" : "kudoEntity", "disallowZeroCount" : "false", { { }, { ', 'ajax'); { "action" : "addClassName" LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); ] "initiatorBinding" : true, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1914089 .lia-rating-control-passive', '#form_1'); "context" : "",

Gucci Fashion Show 2020, Waren Altstadt Bushaltestelle, High Waist Hotpants, Schülerpraktikum Bonn Telekom, Duales Studium Banking And Finance Erfahrungen, Kinderfahrrad Hartz 4, Brokkoli Salat Mit Apfel, Busverbindung Von Schweinfurt Nach Niederwerrn,