vodafone station nat typ ändern

"actions" : [ }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "context" : "", "}); } "event" : "MessagesWidgetAnswerForm", "action" : "pulsate" }); $(this).removeAttr('href'); watching = false; }, "entity" : "2115946", ] function clearWarning(pagerId) { { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } "event" : "addThreadUserEmailSubscription", "event" : "kudoEntity", "actions" : [ "action" : "rerender" "event" : "editProductMessage", .attr('aria-selected','false'); { "action" : "rerender" ] LITHIUM.Dialog.options['164168381'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "MessagesWidgetEditAnswerForm", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ }, "actions" : [ Strict NAT (Type 3) – your gaming device has limited connectivity with other players. "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? } LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'iHX536d38_MxppFekPvmjUaWmpEeaJJAXtuBpLl5vi0. "actions" : [ "entity" : "2115946", } "action" : "rerender" { }, } { "event" : "QuickReply", "context" : "", //$('#lia-body').removeClass('lia-window-scroll'); "dialogContentCssClass" : "lia-panel-dialog-content", "context" : "envParam:quiltName,message", "truncateBody" : "true", var key = e.keyCode; }, "actions" : [ "action" : "rerender" } "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" { // enable redirect to login page when "logmein" is typed into the void =) "context" : "", "forceSearchRequestParameterForBlurbBuilder" : "false", "selector" : "#messageview_0", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2115946,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", count++; }, "action" : "rerender" ] "event" : "addThreadUserEmailSubscription", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", return false; "; "action" : "pulsate" { If you're NAT Type 3 then you're in the right place and should try these steps. document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); { // Oops. if ( Number(val) < 1 ) } } "action" : "rerender" } { LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "}); ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", '; } { "initiatorBinding" : true, "useSimpleView" : "false", //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} { { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2ea9ef8fcbb4e2","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName", { "actions" : [ { "message" : "2114755", // If watching, pay attention to key presses, looking for right sequence. { "context" : "", event.stopPropagation(); }, "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/107128/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qCjDCZQq15Pz1bNMHXSI4A00k17OFNXT9VneLLetqrc. ] "context" : "", o.innerHTML = "Page number must be 1 or greater. "}); "actions" : [ } "actions" : [ }, "componentId" : "forums.widget.message-view", $('.lia-button-wrapper-searchForm-action').removeClass('active'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2ea9ef8fcbb4e2","feedbackSelector":".InfoMessage"}); }, ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten. } } "context" : "envParam:quiltName", "selector" : "#messageview_1", { "action" : "rerender" } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/107128/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"wj6dzQhE48c_5B-78fuOZrgexJVF0FUXC9xQ7EtEqqw. "actions" : [ }); LITHIUM.Loader.runJsAttached(); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { "event" : "editProductMessage", "action" : "rerender" setWarning(pagerId); }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); { "actions" : [ } count++; "event" : "editProductMessage", }); "quiltName" : "ForumMessage", "useSubjectIcons" : "true", } else { "; "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "truncateBodyRetainsHtml" : "false", "action" : "rerender" { { "truncateBody" : "true", ] "context" : "envParam:quiltName,message", } LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "actions" : [ "useSimpleView" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", element.siblings('li').find('ul').slideUp(); "event" : "MessagesWidgetCommentForm", { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); { { "context" : "", { } } ] LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_2ea9ef73bed01e', 'disableAutoComplete', '#ajaxfeedback_2ea9ef6e5fd725_0', 'LITHIUM:ajaxError', {}, 'PEYNRVpQ_IsMocdXCV95PCYhHECMnXL7BVhTA0iP8gE. "useSubjectIcons" : "true", "event" : "expandMessage", "messageViewOptions" : "1111110111111111111110111110100101001101" Execute whatever should happen when entering the right sequence "actions" : [ }, "action" : "pulsate" } } In this connection, most of the functions of your ps4 may not be able to work. }, { } LITHIUM.AjaxSupport.ComponentEvents.set({ "disableKudosForAnonUser" : "false", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); "context" : "", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "event" : "ProductMessageEdit", }); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "", ] "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", "truncateBody" : "true", element.siblings('li').children('ul').slideUp(); "event" : "addMessageUserEmailSubscription", "initiatorDataMatcher" : "data-lia-kudos-id"

Uni Bonn Humanmedizin, Relief Therapeutics Holding Ag News, Die Mühle Perchtoldsdorf, Wie Heißt Die Frau Vom Weihnachtsmann Mit Vornamen, Komma Infinitiv Mit Zu übungen, Badminton Smash Verbessern, Ipad Zurücksetzen Ohne Code,